PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_28672
Common NameKK1_028207
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB
Protein Properties Length: 364aa    MW: 41882.6 Da    PI: 5.522
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_28672genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.66.1e-1373118146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g+W+ eEde l++ v+++G++ W++I ++  + Rt+k+c++rw +
    C.cajan_28672  73 KGPWSSEEDEVLLRHVTKYGPREWSSIRSKGLLPRTGKSCRLRWVN 118
                      79*************************8876677**********87 PP

2Myb_DNA-binding44.73.1e-14129169345
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      ++T+eE+ l +++ +q+G++ W++Ia ++  gRt++++k++w 
    C.cajan_28672 129 KFTAEEERLVIELQAQFGNK-WAKIATYLH-GRTDNDVKNFWS 169
                      79******************.*********.***********6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.34268120IPR017930Myb domain
SuperFamilySSF466894.67E-2871168IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.1E-2071121IPR009057Homeodomain-like
SMARTSM007173.9E-1172122IPR001005SANT/Myb domain
CDDcd001679.22E-1175120No hitNo description
PfamPF139215.5E-1176126No hitNo description
PROSITE profilePS5129420.782121176IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.8E-18122174IPR009057Homeodomain-like
SMARTSM007176.2E-12126174IPR001005SANT/Myb domain
PfamPF002491.2E-12129169IPR001005SANT/Myb domain
CDDcd001672.62E-10129168No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MTCILTSYVC MFVFELNVIC RTRTVHALTR ESNHTGVKPS ISNTFSGAFY LIRENIETNV  60
EMEKEFDRGY IKKGPWSSEE DEVLLRHVTK YGPREWSSIR SKGLLPRTGK SCRLRWVNKL  120
RPNLKTGCKF TAEEERLVIE LQAQFGNKWA KIATYLHGRT DNDVKNFWSS RRKRLERMLQ  180
RPPTLKPHKN KGKLPLNLVQ VEKVPPCSSN QVEENLSYLT SYMGNNEVFE MINLPDLIKP  240
NYQYLESDPL SAVEVEVDAT PLHTVPSFES SSGYNFPLLP EPLMDYPLFP ECHDLVPEPF  300
DPNFIDEFEQ KKCSEGVCSQ ELETMLPTLG FEGNSQSTSS NGLFKDFSSE IFEYFEQIPT  360
SSEV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-277117325127MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007133863.11e-179hypothetical protein PHAVU_011G215300g
TrEMBLA0A151S5I50.0A0A151S5I5_CAJCA; Transcription factor GAMYB
STRINGGLYMA12G37026.11e-175(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36933164
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60460.13e-63MYB family protein